PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10027415m
Common NameCICLE_v10027415mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 162aa    MW: 18479.8 Da    PI: 8.9261
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10027415mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-132181363
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     ++ rerr+  NReAArrsR RK+++  +L   +   ++eN + +  ++  ++ +++l +e+
  Ciclev10027415m 21 DDYRERRMKANREAARRSRMRKQEYFHHLIADISRYQKENGQIRAMISLVTQAYSNLMNEN 81
                     5679***************************************************998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-161983IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.0132184IPR004827Basic-leucine zipper domain
CDDcd147021.48E-162475No hitNo description
PfamPF001701.6E-92481IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.1E-112491No hitNo description
SuperFamilySSF579592.0E-102478No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MASSSGNYSI RSDMLQNSTS DDYRERRMKA NREAARRSRM RKQEYFHHLI ADISRYQKEN  60
GQIRAMISLV TQAYSNLMNE NAVLRSQLAQ LQHRLHSLNG LIASTNAVYF DQPATLQFLA  120
NCTSNELIVD DYLGNSDTFN YPYLSQPTIT VPPFNNGLFM L*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13542RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425616.11e-117hypothetical protein CICLE_v10027415mg
TrEMBLV4SP411e-117V4SP41_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.17e-23basic leucine-zipper 44